#include <stdio.h>
//#include "SubLoc.h"
#include "soapH.h"
#include "SOAPBinding.nsmap"
// example code for illustrate how to writting SubLoc SOAP client using C

//for the illustration of functions and paameters, see http://www.bioinfo.tsinghua.edu.cn/~guotao/soapserver.html.
int main()
{
  struct soap soap;
  soap_init(&soap);
// for blast search
  char p1[] = "all";
  char p2[] = "full";
  char seq[] = "TKRFFNKNNRLNKGYAKTFSINEPDNNFYRKKFEHILPPVDLISEYESIYPGTLQELMHMAQKEQAHKHAIDLKNLKIQERIAKLTRICLLIFGIGLVVLIFLKLLK";
  char e[] = "1";
  struct ns1__blast_USCOREsearchResponse blast_response;
  soap_call_ns1__blast_USCOREsearch(&soap, NULL, NULL, p1, p2, seq, e, &blast_response);
  // get the parsed results
  printf("%s\n", blast_response.return_->parsed);
  // get the original outputs of BLAST
  printf("%s\n", blast_response.return_->plain);

// Subcellular Location Prediction by SVM
// for more details about the method, please see:
// Hua, S. and Sun, Z. (2001). Support vector machine approach for protein subcellular localization prediction. Bioinformatics 17, 721-8.

// for eukaryotic organisms 
	struct ns1__eu_USCOREpredictResponse eu_response;
	soap_call_ns1__eu_USCOREpredict(&soap, NULL, NULL, seq, &eu_response);
// get predicted location
	printf("%s\n", eu_response.return_->Prediction);
// get Reliability Index
	printf("%s\n", eu_response.return_->RI);
// get Expected Accuracy
	printf("%s\n", eu_response.return_->ExpectAcc);

// for prokaryotic organisms 
	struct ns1__pro_USCOREpredictResponse pro_response;
	soap_call_ns1__pro_USCOREpredict(&soap, NULL, NULL, seq, &pro_response);
// get predicted location
	printf("%s\n", pro_response.return_->Prediction);
// get Reliability Index
	printf("%s\n", pro_response.return_->RI);
// get Expected Accuracy
	printf("%s\n", pro_response.return_->ExpectAcc);

//################# SubLoc prediction by PSORT
// for more details about PSORT, please refer:
// Nakai, K. and Horton, P. (1999). PSORT: a program for detecting sorting signals in proteins and
// predicting their subcellular localization. Trends Biochem Sci 24, 34-6.
	struct ns1__psort_USCOREpredictResponse psort_response;
	soap_call_ns1__psort_USCOREpredict(&soap, NULL, NULL, seq, &psort_response);
// get predicted location
	printf("%s\n", psort_response.return_->Prediction);
// get Details 
	printf("%s\n", psort_response.return_->Detail);

// name search
	char query_name[] = "p53";
	struct ns1__name_USCOREsearchResponse name_response;
	soap_call_ns1__name_USCOREsearch(&soap, NULL, NULL, query_name, &name_response);
	int i, len = name_response.return_->__size;
	for (i=0; i<len; i++)
	{
// get all entries' ID SQ LC CX DE OS
// SQ=sequence, LC=location, CX=cross database id, DE=description, OS=organism

		printf("%s%s%s%s%s%s\n",
				(*(name_response.return_)->__ptr)->ID,
				(*(name_response.return_)->__ptr)->LC,
				(*(name_response.return_)->__ptr)->CX,
				(*(name_response.return_)->__ptr)->SQ,
				(*(name_response.return_)->__ptr)->OS,
				(*(name_response.return_)->__ptr)->DE
				);
	}	

// id_search
	// by SWISSPROT ID
	char id_class[] = "SWISSPROT";
	char query_id[] = "O03978";
	//or by DBSubLoc ID
	//char id_class[] = "DBSubLoc";
	//char query_id[] = "10043258";
	// or by GO ID
	//char id_class[] = "GO";
	//char query_id[] = "0005739";

	struct ns1__id_USCOREsearchResponse id_response;
	soap_call_ns1__id_USCOREsearch(&soap, NULL, NULL, id_class, query_id, &id_response);
	len = id_response.return_->__size;
	for (i=0; i<len; i++)
	{
		printf("%s%s%s%s%s%s\n",
				(*(id_response.return_)->__ptr)->ID,
				(*(id_response.return_)->__ptr)->LC,
				(*(id_response.return_)->__ptr)->CX,
				(*(id_response.return_)->__ptr)->SQ,
				(*(id_response.return_)->__ptr)->OS,
				(*(id_response.return_)->__ptr)->DE
				);
	}	
//feed_entry users coulde submit new sequences to the database by this function
	struct ns1__feed_USCOREentryResponse feed_response;
	soap_call_ns1__feed_USCOREentry(&soap,NULL,NULL,"p53","cancer inhibitor","human","nuclear","cross references","Sequences Here: XXXX",&feed_response);
	//len = feed_response.return_->__size;
	printf("%s\n", feed_response.return_);

  return 0;
}